Home  >  Products  >  anti-Sex Comb On Midleg Homolog 1 (Drosophila) (SCMH1) (Middle Region) antibody
anti-Sex Comb On Midleg Homolog 1 (Drosophila) (SCMH1) (Middle Region) antibody

anti-Sex Comb On Midleg Homolog 1 (Drosophila) (SCMH1) (Middle Region) antibody

Cat no: ABIN404758

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Sex Comb On Midleg Homolog 1 (Drosophila) (SCMH1) (Middle Region) antibody: This is a rabbit polyclonal antibody against SCMH1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404758
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 768916,22955,482448,540926,29871,362581
Concentration: 1 mg/mL
Antigen: SCMH1
Clonality: Polyclonal
Sequence: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVL EHQPGQRGRK
Molecular weight: 65 kDa
Entrez gene: 768916,22955,482448,540926,29871,362581

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave