Home  >  Products  >  anti-Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7) (Middle Region) antibody
anti-Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7) (Middle Region) antibody

anti-Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7) (Middle Region) antibody

Cat no: ABIN503396

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7) (Middle Region) antibody: This is a rabbit polyclonal antibody against SDR-O. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503396
Reactivities: Human, Mouse, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 121214,538876,70061
Concentration: 1 mg/mL
Antigen: SDR-O
Clonality: Polyclonal
Sequence: SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFIL SRYLPRPADS
Molecular weight: 35 kDa
Entrez gene: 121214,538876,70061

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave