Home  >  Products  >  anti-Signal Recognition Particle Receptor (Docking Protein) (SRPR) (Middle Region) antibody

anti-Signal Recognition Particle Receptor (Docking Protein) (SRPR) (Middle Region) antibody

Cat no: ABIN405327


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Signal Recognition Particle Receptor (Docking Protein) (SRPR) (Middle Region) antibody: This is a rabbit polyclonal antibody against SRPR. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405327
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6734,489293,281504,67398,315548
Concentration: 1 mg/mL
Antigen: SRPR
Clonality: Polyclonal
Sequence: EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCA NKEVLDYSTP
Molecular weight: 70 kDa
Entrez gene: 6734,489293,281504,67398,315548

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave