Home  >  Products  >  anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (N-Term) antibody
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (N-Term) antibody

anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (N-Term) antibody

Cat no: ABIN310681

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (N-Term) antibody: This is a rabbit polyclonal antibody against SSR2. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310681
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 83414,379368,425656,6746,403950,506530,66256,295235
Concentration: 1 mg/mL
Antigen: SSR2
Clonality: Polyclonal
Sequence: SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQY NIYNVGSSAA
Molecular weight: 20 kDa
Entrez gene: 83414,379368,425656,6746,403950,506530,66256,295235

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave