Home  >  Products  >  anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (N-Term) antibody

anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (N-Term) antibody

Cat no: ABIN309694


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (N-Term) antibody: This is a rabbit polyclonal antibody against STAT1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN309694
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6772,488449,396655,510814,20846,25124
Concentration: 1 mg/mL
Antigen: STAT1
Clonality: Polyclonal
Sequence: LQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNK QVLWDRTFSL
Molecular weight: 87 kDa
Entrez gene: 6772,488449,396655,510814,20846,25124

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave