Home  >  Products  >  anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) (Middle Region) antibody
anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) (Middle Region) antibody

anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) (Middle Region) antibody

Cat no: ABIN504617

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) (Middle Region) antibody: This is a rabbit polyclonal antibody against STAT3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504617
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 779100,6774,490967,733648,508541,20848,25125
Concentration: 1 mg/mL
Antigen: STAT3
Clonality: Polyclonal
Sequence: FGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI DLPMSPRTLD
Molecular weight: 88 kDa
Entrez gene: 779100,6774,490967,733648,508541,20848,25125

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave