Home  >  Products  >  anti-Signal Transducer and Activator of Transcription 4 (STAT4) (N-Term) antibody
anti-Signal Transducer and Activator of Transcription 4 (STAT4) (N-Term) antibody

anti-Signal Transducer and Activator of Transcription 4 (STAT4) (N-Term) antibody

Cat no: ABIN182791

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Signal Transducer and Activator of Transcription 4 (STAT4) (N-Term) antibody: This is a rabbit polyclonal antibody against STAT4. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182791
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 768406,6775,478845,397261,515988,20849,367264
Concentration: 1 mg/mL
Antigen: STAT4
Clonality: Polyclonal
Sequence: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKM TYEGDPIPMQ
Molecular weight: 86 kDa
Entrez gene: 768406,6775,478845,397261,515988,20849,367264

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave