Home  >  Products  >  anti-Signal Transducer and Activator of Transcription 5A (STAT5A) (C-Term) antibody
anti-Signal Transducer and Activator of Transcription 5A (STAT5A) (C-Term) antibody

anti-Signal Transducer and Activator of Transcription 5A (STAT5A) (C-Term) antibody

Cat no: ABIN501656

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Signal Transducer and Activator of Transcription 5A (STAT5A) (C-Term) antibody: This is a rabbit polyclonal antibody against STAT5A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501656
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6776,490968,397550,282375,20850,24918
Concentration: 1 mg/mL
Antigen: STAT5A
Clonality: Polyclonal
Sequence: DQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVA RHVEELLRRP
Molecular weight: 91 kDa
Entrez gene: 6776,490968,397550,282375,20850,24918

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave