Home  >  Products  >  anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) (C-Term) antibody

anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) (C-Term) antibody

Cat no: ABIN309873


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) (C-Term) antibody: This is a rabbit polyclonal antibody against STAT6. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN309873
Reactivities: Human, Mouse, Rat, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6778,100142679,100153518,20852,362896
Concentration: 1 mg/mL
Antigen: STAT6
Clonality: Polyclonal
Sequence: TEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS HMDLRANPSW
Molecular weight: 94 kDa
Entrez gene: 6778,100142679,100153518,20852,362896

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave