Home  >  Products  >  anti-SIL1 Homolog, Endoplasmic Reticulum Chaperone (S. Cerevisiae) (SIL1) (C-Term) antibody
anti-SIL1 Homolog, Endoplasmic Reticulum Chaperone (S. Cerevisiae) (SIL1) (C-Term) antibody

anti-SIL1 Homolog, Endoplasmic Reticulum Chaperone (S. Cerevisiae) (SIL1) (C-Term) antibody

Cat no: ABIN405708

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-SIL1 Homolog, Endoplasmic Reticulum Chaperone (S. Cerevisiae) (SIL1) (C-Term) antibody: This is a rabbit polyclonal antibody against SIL1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405708
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 64374,520650,81500,291673
Concentration: 1 mg/mL
Antigen: SIL1
Clonality: Polyclonal
Sequence: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQ TLGVLLTTCR
Molecular weight: 49 kDa
Entrez gene: 64374,520650,81500,291673

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave