Home  >  Products  >  anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody
anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody

anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody

Cat no: ABIN501700

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody: This is a rabbit polyclonal antibody against SIM2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501700
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Drosophila/Arthropod, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 114450,373634,418515,6493,607987,100337422,20465,304071
Concentration: 1 mg/mL
Antigen: SIM2
Clonality: Polyclonal
Sequence: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKA SIIRLTTSYL
Molecular weight: 73 kDa
Entrez gene: 114450,373634,418515,6493,607987,100337422,20465,304071

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave