Home  >  Products  >  anti-Small Nuclear RNA Activating Complex, Polypeptide 1, 43kDa (SNAPC1) (C-Term) antibody

anti-Small Nuclear RNA Activating Complex, Polypeptide 1, 43kDa (SNAPC1) (C-Term) antibody

Cat no: ABIN309866


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Small Nuclear RNA Activating Complex, Polypeptide 1, 43kDa (SNAPC1) (C-Term) antibody: This is a rabbit polyclonal antibody against SNAPC1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN309866
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Accession: Q16533
Gene: 6617
Concentration: 1 mg/mL
Antigen: SNAPC1
Clonality: Polyclonal
Sequence: GQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDK PLSLSMPVIT
Molecular weight: 43 kDa
Entrez gene: 6617

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave