Home  >  Products  >  anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (C-Term) antibody
anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (C-Term) antibody

anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (C-Term) antibody

Cat no: ABIN504385

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (C-Term) antibody: This is a rabbit polyclonal antibody against SNF8. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504385
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100037233,419990,11267,491063,505628,27681,287645
Concentration: 1 mg/mL
Antigen: SNF8
Clonality: Polyclonal
Sequence: QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITA EEAREALP
Molecular weight: 29 kDa
Entrez gene: 100037233,419990,11267,491063,505628,27681,287645

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave