Home  >  Products  >  anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody

anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody

Cat no: ABIN182378


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody: This is a rabbit polyclonal antibody against SNF8. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182378
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: Q96H20
Gene: 11267
Concentration: 1 mg/mL
Antigen: EAP30
Clonality: Polyclonal
Sequence: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQL DMFKTNLEEF
Molecular weight: 29 kDa
Entrez gene: 11267

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave