Home  >  Products  >  anti-SNW Domain Containing 1 (SNW1) (N-Term) antibody
anti-SNW Domain Containing 1 (SNW1) (N-Term) antibody

anti-SNW Domain Containing 1 (SNW1) (N-Term) antibody

Cat no: ABIN182523

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-SNW Domain Containing 1 (SNW1) (N-Term) antibody: This is a rabbit polyclonal antibody against SKIIP. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182523
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 734970,22938,326578,66354,299219
Concentration: 1 mg/mL
Antigen: SKIIP
Clonality: Polyclonal
Sequence: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKE ITEKTRVALE
Molecular weight: 61 kDa
Entrez gene: 734970,22938,326578,66354,299219

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave