Home  >  Products  >  anti-Solute Carrier Family 1 Member 5 (SLC1A5) (Middle Region) antibody

anti-Solute Carrier Family 1 Member 5 (SLC1A5) (Middle Region) antibody

Cat no: ABIN310308


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Solute Carrier Family 1 Member 5 (SLC1A5) (Middle Region) antibody: This is a rabbit polyclonal antibody against SLC1A5. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310308
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 100002129,444522,6510,484425,282355,100009234,20514,292657
Concentration: 1 mg/mL
Antigen: SLC1A5
Clonality: Polyclonal
Sequence: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVG IMFLVAGKIV
Molecular weight: 60 kDa
Entrez gene: 100002129,444522,6510,484425,282355,100009234,20514,292657

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave