Home  >  Products  >  anti-Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1) (N-Term) antibody
anti-Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1) (N-Term) antibody

anti-Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1) (N-Term) antibody

Cat no: ABIN502443

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC1A1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502443
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6505,403751,397003,282353,100009070,20510,25550
Concentration: 1 mg/mL
Antigen: SLC1A1
Clonality: Polyclonal
Sequence: VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSM ITGVAALDSN
Molecular weight: 57 kDa
Entrez gene: 6505,403751,397003,282353,100009070,20510,25550

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave