Home  >  Products  >  anti-Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) (C-Term) antibody
anti-Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) (C-Term) antibody

anti-Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) (C-Term) antibody

Cat no: ABIN310505

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) (C-Term) antibody: This is a rabbit polyclonal antibody against SLC12A2. It was validated on Western Blot.
Catalogue number: ABIN310505
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 6558,481490,286845,20496,83629
Concentration: 1 mg/mL
Antigen: SLC12A2
Clonality: Polyclonal
Sequence: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELE LYKTKTYRQI
Molecular weight: 131 kDa
Entrez gene: 6558,481490,286845,20496,83629

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave