Home  >  Products  >  anti-Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1) (C-Term) antibody
anti-Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1) (C-Term) antibody

anti-Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1) (C-Term) antibody

Cat no: ABIN310975

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1) (C-Term) antibody: This is a rabbit polyclonal antibody against SLC14A1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310975
Reactivities: Human, Mouse, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 6563,490470,493988,108052
Concentration: 1 mg/mL
Antigen: SLC14A1
Clonality: Polyclonal
Sequence: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNS SLACIAMGGM
Molecular weight: 42 kDa
Entrez gene: 6563,490470,493988,108052

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave