Home  >  Products  >  anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (N-Term) antibody
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (N-Term) antibody

anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (N-Term) antibody

Cat no: ABIN310524

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC17A5. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310524
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 100158341,421863,26503,474969,530164,100328660,235504,363103
Concentration: 1 mg/mL
Antigen: SLC17A5
Clonality: Polyclonal
Sequence: LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWA PPLERSKLLS
Molecular weight: 55 kDa
Entrez gene: 100158341,421863,26503,474969,530164,100328660,235504,363103

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave