Home  >  Products  >  anti-Solute Carrier Family 17 (Anion/Sugar Transporter), Member 4 (SLC17A4) (Middle Region) antibody

anti-Solute Carrier Family 17 (Anion/Sugar Transporter), Member 4 (SLC17A4) (Middle Region) antibody

Cat no: ABIN310519


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Solute Carrier Family 17 (Anion/Sugar Transporter), Member 4 (SLC17A4) (Middle Region) antibody: This is a rabbit polyclonal antibody against SLC17A4. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310519
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 10050,512725,319848,679784
Concentration: 1 mg/mL
Antigen: SLC17A4
Clonality: Polyclonal
Sequence: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVV GCICIILGGL
Molecular weight: 55 kDa
Entrez gene: 10050,512725,319848,679784

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave