Home  >  Products  >  anti-Solute Carrier Family 18 (Vesicular Monoamine), Member 1 (SLC18A1) (N-Term) antibody

anti-Solute Carrier Family 18 (Vesicular Monoamine), Member 1 (SLC18A1) (N-Term) antibody

Cat no: ABIN183200


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Solute Carrier Family 18 (Vesicular Monoamine), Member 1 (SLC18A1) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC18A1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183200
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: P54219
Gene: 6570
Concentration: 1 mg/mL
Antigen: SLC18A1
Clonality: Polyclonal
Sequence: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVL FASKAVMQLL
Molecular weight: 56 kDa
Entrez gene: 6570

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave