Home  >  Products  >  anti-Solute Carrier Family 2 (Facilitated Glucose/fructose Transporter), Member 5 (SLC2A5) (Middle Region) antibody
anti-Solute Carrier Family 2 (Facilitated Glucose/fructose Transporter), Member 5 (SLC2A5) (Middle Region) antibody

anti-Solute Carrier Family 2 (Facilitated Glucose/fructose Transporter), Member 5 (SLC2A5) (Middle Region) antibody

Cat no: ABIN310280

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 2 (Facilitated Glucose/fructose Transporter), Member 5 (SLC2A5) (Middle Region) antibody: This is a rabbit polyclonal antibody against SLC2A5. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310280
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6518,489640,282868,56485,65197
Concentration: 1 mg/mL
Antigen: SLC2A5
Clonality: Polyclonal
Sequence: ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELL GRRLLLLLGF
Molecular weight: 55 kDa
Entrez gene: 6518,489640,282868,56485,65197

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave