Home  >  Products  >  anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 2 (SLC2A2) (N-Term) antibody
anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 2 (SLC2A2) (N-Term) antibody

anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 2 (SLC2A2) (N-Term) antibody

Cat no: ABIN310208

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 2 (SLC2A2) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC2A2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310208
Reactivities: Human, Mouse, Rat, Bovine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6514,397429,282357,20526,25351
Concentration: 1 mg/mL
Antigen: SLC2A2
Clonality: Polyclonal
Sequence: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRK AINNYVINST
Molecular weight: 58 kDa
Entrez gene: 6514,397429,282357,20526,25351

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave