Home  >  Products  >  anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (N-Term) antibody

anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (N-Term) antibody

Cat no: ABIN310514


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC22A2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310514
Reactivities: Human, Mouse, Rat, Bovine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 6582,396936,521027,100008831,20518,29503
Concentration: 1 mg/mL
Antigen: SLC22A2
Clonality: Polyclonal
Sequence: MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGI VFLGFTPDHR
Molecular weight: 62 kDa
Entrez gene: 6582,396936,521027,100008831,20518,29503

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave