Home  >  Products  >  anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7) (N-Term) antibody

anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7) (N-Term) antibody

Cat no: ABIN310317


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC22A7. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310317
Reactivities: Human, Rat, Bovine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 10864,733693,407224,100009335,89776
Concentration: 1 mg/mL
Antigen: SLC22A7
Clonality: Polyclonal
Sequence: LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALP NTTLGEERQS
Molecular weight: 60 kDa
Entrez gene: 10864,733693,407224,100009335,89776

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave