Home  >  Products  >  anti-Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1) (Middle Region) antibody
anti-Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1) (Middle Region) antibody

anti-Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1) (Middle Region) antibody

Cat no: ABIN405602

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1) (Middle Region) antibody: This is a rabbit polyclonal antibody against SLC24A1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405602
Reactivities: Human, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 9187,100683168,56814
Concentration: 1 mg/mL
Antigen: SLC24A1
Clonality: Polyclonal
Sequence: EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPS LLTRGSSSTS
Molecular weight: 121 kDa
Entrez gene: 9187,100683168,56814

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave