Home  >  Products  >  anti-Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6) (Middle Region) antibody

anti-Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6) (Middle Region) antibody

Cat no: ABIN405617


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6) (Middle Region) antibody: This is a rabbit polyclonal antibody against SLC24A6. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405617
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100190771,80024,486280,508887,170756,498185
Concentration: 1 mg/mL
Antigen: SLC24A6
Clonality: Polyclonal
Sequence: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGC LLQISRSHTE
Molecular weight: 64 kDa
Entrez gene: 100190771,80024,486280,508887,170756,498185

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave