Home  >  Products  >  anti-Solute Carrier Family 25, Member 28 (SLC25A28) (C-Term) antibody

anti-Solute Carrier Family 25, Member 28 (SLC25A28) (C-Term) antibody

Cat no: ABIN310543


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Solute Carrier Family 25, Member 28 (SLC25A28) (C-Term) antibody: This is a rabbit polyclonal antibody against SLC25A28. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310543
Reactivities: Human, Mouse, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 81894,486837,538529,246696
Concentration: 1 mg/mL
Antigen: SLC25A28
Clonality: Polyclonal
Sequence: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQ ARVIYQIPST
Molecular weight: 39 kDa
Entrez gene: 81894,486837,538529,246696

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave