Home  >  Products  >  anti-Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31) (N-Term) antibody
anti-Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31) (N-Term) antibody

anti-Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31) (N-Term) antibody

Cat no: ABIN311653

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC25A31. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311653
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 83447,483832,541168,73333,689108
Concentration: 1 mg/mL
Antigen: SLC25A31
Clonality: Polyclonal
Sequence: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYK GMVDCLVRIP
Molecular weight: 35 kDa
Entrez gene: 83447,483832,541168,73333,689108

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave