Home  >  Products  >  anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (N-Term) antibody
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (N-Term) antibody

anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (N-Term) antibody

Cat no: ABIN405618

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC25A21. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405618
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Drosophila/Arthropod, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 767694,779440,423330,89874,513423,217593,171151
Concentration: 1 mg/mL
Antigen: SLC25A21
Clonality: Polyclonal
Sequence: FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALT FAIAGLGSGL
Molecular weight: 33 kDa
Entrez gene: 767694,779440,423330,89874,513423,217593,171151

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave