Home  >  Products  >  anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (Middle Region) antibody
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (Middle Region) antibody

anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (Middle Region) antibody

Cat no: ABIN502148

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (Middle Region) antibody: This is a rabbit polyclonal antibody against SLC27A5. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502148
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9Y2P5
Gene: 10998
Concentration: 1 mg/mL
Antigen: SLC27A5
Clonality: Polyclonal
Sequence: KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVR EGFNVGIVVD
Molecular weight: 75 kDa
Entrez gene: 10998

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave