Home  >  Products  >  anti-Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8) (N-Term) antibody
anti-Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8) (N-Term) antibody

anti-Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8) (N-Term) antibody

Cat no: ABIN310309

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8) (N-Term) antibody: This is a rabbit polyclonal antibody against SLC6A8. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310309
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 6535,492242,100302506,282367,100009280,102857,50690
Concentration: 1 mg/mL
Antigen: SLC6A8
Clonality: Polyclonal
Sequence: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCL LACWVLVYFC
Molecular weight: 70 kDa
Entrez gene: 6535,492242,100302506,282367,100009280,102857,50690

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave