Home  >  Products  >  anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody
anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody

anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody

Cat no: ABIN310516

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody: This is a rabbit polyclonal antibody against SLC7A4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310516
Reactivities: Human, Mouse, Rat, Bovine, Canine, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 796100,6545,486435,504923,224022,303787
Concentration: 1 mg/mL
Antigen: SLC7A4
Clonality: Polyclonal
Sequence: GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFI VAAGSICAMN
Molecular weight: 68 kDa
Entrez gene: 796100,6545,486435,504923,224022,303787

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave