Home  >  Products  >  anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) (Middle Region) antibody
anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) (Middle Region) antibody

anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) (Middle Region) antibody

Cat no: ABIN501857

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-SRY (Sex Determining Region Y)-Box 7 (SOX7) (Middle Region) antibody: This is a rabbit polyclonal antibody against SOX7. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501857
Reactivities: Human, Mouse, Rat
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 83595,20680,290317
Concentration: 1 mg/mL
Antigen: SOX7
Clonality: Polyclonal
Sequence: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTP TGPTETSLIS
Molecular weight: 42 kDa
Entrez gene: 83595,20680,290317

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave