Home  >  Products  >  anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody
anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody

anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody

Cat no: ABIN183977

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) (N-Term) antibody: This is a rabbit polyclonal antibody against STAU1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183977
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 6780,513944,20853,84496
Concentration: 1 mg/mL
Antigen: STAU1
Clonality: Polyclonal
Sequence: LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLE VNGRESEEEN
Molecular weight: 63 kDa
Entrez gene: 6780,513944,20853,84496

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave