Home  >  Products  >  anti-Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2) (N-Term) antibody

anti-Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2) (N-Term) antibody

Cat no: ABIN502491


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2) (N-Term) antibody: This is a rabbit polyclonal antibody against SRD5A2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502491
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: P31213
Gene: 6716
Concentration: 1 mg/mL
Antigen: SRD5A2
Clonality: Polyclonal
Sequence: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESL KPAATRLPAR
Molecular weight: 28 kDa
Entrez gene: 6716

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave