Home  >  Products  >  anti-Sterol Regulatory Element Binding Transcription Factor 1 (SREBF1) (Middle Region) antibody

anti-Sterol Regulatory Element Binding Transcription Factor 1 (SREBF1) (Middle Region) antibody

Cat no: ABIN311739


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Sterol Regulatory Element Binding Transcription Factor 1 (SREBF1) (Middle Region) antibody: This is a rabbit polyclonal antibody against SREBF1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN311739
Reactivities: Human, Mouse, Rat, Bovine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 6720,397308,539361,20787,78968
Concentration: 1 mg/mL
Antigen: SREBF1
Clonality: Polyclonal
Sequence: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAK PEQRPSLHSR
Molecular weight: 125 kDa
Entrez gene: 6720,397308,539361,20787,78968

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave