Home  >  Products  >  anti-Suppressor of Variegation 3-9 Homolog 1 (Drosophila) (SUV39H1) (N-Term) antibody

anti-Suppressor of Variegation 3-9 Homolog 1 (Drosophila) (SUV39H1) (N-Term) antibody

Cat no: ABIN486939


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Suppressor of Variegation 3-9 Homolog 1 (Drosophila) (SUV39H1) (N-Term) antibody: This is a rabbit polyclonal antibody against SUV39H1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN486939
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6839,491868,523047,20937,302553
Concentration: 1 mg/mL
Antigen: SUV39H1
Clonality: Polyclonal
Sequence: RHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITV ENEVDLDGPP
Molecular weight: 48 kDa
Entrez gene: 6839,491868,523047,20937,302553

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave