Home  >  Products  >  anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1) (N-Term) antibody
anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1) (N-Term) antibody

anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1) (N-Term) antibody

Cat no: ABIN501293

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1) (N-Term) antibody: This is a rabbit polyclonal antibody against SMARCA1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501293
Reactivities: Human, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 6594,481046,317575
Concentration: 1 mg/mL
Antigen: SMARCA1
Clonality: Polyclonal
Sequence: QEEGAAAAATEATAATEKGEKKKEKNVSSFQLKLAAKAPK SEKEMDPEYE
Molecular weight: 120 kDa
Entrez gene: 6594,481046,317575

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave