Home  >  Products  >  anti-TAF1 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 250kDa (TAF1) (Middle Region) antibody

anti-TAF1 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 250kDa (TAF1) (Middle Region) antibody

Cat no: ABIN404804


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-TAF1 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 250kDa (TAF1) (Middle Region) antibody: This is a rabbit polyclonal antibody against TAF1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404804
Reactivities: Human, Mouse, Rat, Canine
Hosts: Rabbit
Applications: ChIP, Immunoprecipitation, Western Blot
Size: 50 micro g
Gene: 6872,491950,270627,317256
Concentration: 1 mg/mL
Antigen: TAF1
Clonality: Polyclonal
Sequence: MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFS SIGGYEVSEE
Molecular weight: 215 kDa
Entrez gene: 6872,491950,270627,317256

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave