Home  >  Products  >  anti-TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13) (N-Term) antibody
anti-TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13) (N-Term) antibody

anti-TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13) (N-Term) antibody

Cat no: ABIN502864

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13) (N-Term) antibody: This is a rabbit polyclonal antibody against TAF13. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502864
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 734281,418365,6884,100688743,513065,99730,310784
Concentration: 1 mg/mL
Antigen: TAF13
Clonality: Polyclonal
Sequence: ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMY GFGDDQNPYT
Molecular weight: 14 kDa
Entrez gene: 734281,418365,6884,100688743,513065,99730,310784

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave