Home  >  Products  >  anti-TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 135kDa (TAF4) (Middle Region) antibody
anti-TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 135kDa (TAF4) (Middle Region) antibody

anti-TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 135kDa (TAF4) (Middle Region) antibody

Cat no: ABIN487064

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 135kDa (TAF4) (Middle Region) antibody: This is a rabbit polyclonal antibody against TAF4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN487064
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: ChIP, Immunoprecipitation, Western Blot
Size: 50 micro g
Gene: 100037075,419223,6874,477280,100626452,789854
Concentration: 1 mg/mL
Antigen: TAF4
Clonality: Polyclonal
Sequence: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRS RQEDPEQLRL
Molecular weight: 110 kDa
Entrez gene: 100037075,419223,6874,477280,100626452,789854

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave