Home  >  Products  >  anti-TAF6 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 80kDa (TAF6) (C-Term) antibody

anti-TAF6 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 80kDa (TAF6) (C-Term) antibody

Cat no: ABIN501719


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-TAF6 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 80kDa (TAF6) (C-Term) antibody: This is a rabbit polyclonal antibody against TAF6. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501719
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: ChIP, Immunoprecipitation, Western Blot
Size: 50 micro g
Gene: 6878,489846,505638,21343,288533
Concentration: 1 mg/mL
Antigen: TAF6
Clonality: Polyclonal
Sequence: PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTG EGKGGPTSHP
Molecular weight: 73 kDa
Entrez gene: 6878,489846,505638,21343,288533

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave