Home  >  Products  >  anti-TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase I, C, 110kDa (TAF1C) (N-Term) antibody

anti-TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase I, C, 110kDa (TAF1C) (N-Term) antibody

Cat no: ABIN504377


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase I, C, 110kDa (TAF1C) (N-Term) antibody: This is a rabbit polyclonal antibody against TAF1C. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504377
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 9013,609622,509238,21341,361420
Concentration: 1 mg/mL
Antigen: TAF1C
Clonality: Polyclonal
Sequence: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEA QPQNSENGAL
Molecular weight: 95 kDa
Entrez gene: 9013,609622,509238,21341,361420

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave