Home  >  Products  >  anti-TEA Domain Family Member 1 (SV40 Transcriptional Enhancer Factor) (TEAD1) (Middle Region) antibody
anti-TEA Domain Family Member 1 (SV40 Transcriptional Enhancer Factor) (TEAD1) (Middle Region) antibody

anti-TEA Domain Family Member 1 (SV40 Transcriptional Enhancer Factor) (TEAD1) (Middle Region) antibody

Cat no: ABIN486822

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-TEA Domain Family Member 1 (SV40 Transcriptional Enhancer Factor) (TEAD1) (Middle Region) antibody: This is a rabbit polyclonal antibody against TEAD1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN486822
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100006454,100126656,403089,7003,536560,21676,361630
Concentration: 1 mg/mL
Antigen: TEAD1
Clonality: Polyclonal
Sequence: PASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSY NKHLFVHIGH
Molecular weight: 46 kDa
Entrez gene: 100006454,100126656,403089,7003,536560,21676,361630

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave