Home  >  Products  >  anti-TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody
anti-TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody

anti-TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody

Cat no: ABIN183296

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody: This is a rabbit polyclonal antibody against TGIF2LY. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183296
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Accession: Q8IUE0
Gene: 90655
Concentration: 1 mg/mL
Antigen: TGIF2LY
Clonality: Polyclonal
Sequence: NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQST EASVPAKSGP
Molecular weight: 21 kDa
Entrez gene: 90655

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave