Home  >  Products  >  anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (N-Term) antibody
anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (N-Term) antibody

anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (N-Term) antibody

Cat no: ABIN183210

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (N-Term) antibody: This is a rabbit polyclonal antibody against TRIP13. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183210
Reactivities: Human, Mouse, Rat, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 100037172,420798,9319,609426,100337674,69716,292206
Concentration: 1 mg/mL
Antigen: TRIP13
Clonality: Polyclonal
Sequence: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAA NHWVLPAAEF
Molecular weight: 49 kDa
Entrez gene: 100037172,420798,9319,609426,100337674,69716,292206

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave