Home  >  Products  >  anti-Tight Junction Protein 1 (Zona Occludens 1) (TJP1) (Middle Region) antibody
anti-Tight Junction Protein 1 (Zona Occludens 1) (TJP1) (Middle Region) antibody

anti-Tight Junction Protein 1 (Zona Occludens 1) (TJP1) (Middle Region) antibody

Cat no: ABIN501576

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Tight Junction Protein 1 (Zona Occludens 1) (TJP1) (Middle Region) antibody: This is a rabbit polyclonal antibody against TJP1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501576
Reactivities: Human, Mouse, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 7082,403752,21872
Concentration: 1 mg/mL
Antigen: TJP1
Clonality: Polyclonal
Sequence: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDL EQPTYRYESS
Molecular weight: 187 kDa
Entrez gene: 7082,403752,21872

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave