Home  >  Products  >  anti-Tissue Specific Transplantation Antigen P35B (TSTA3) (N-Term) antibody
anti-Tissue Specific Transplantation Antigen P35B (TSTA3) (N-Term) antibody

anti-Tissue Specific Transplantation Antigen P35B (TSTA3) (N-Term) antibody

Cat no: ABIN406731

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Tissue Specific Transplantation Antigen P35B (TSTA3) (N-Term) antibody: This is a rabbit polyclonal antibody against TSTA3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406731
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 7264,475116,513158,22122,300036
Concentration: 1 mg/mL
Antigen: TSTA3
Clonality: Polyclonal
Sequence: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVF VSSKDADLTD
Molecular weight: 35 kDa
Entrez gene: 7264,475116,513158,22122,300036

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave